PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01942.1.p
Common NameEUGRSUZ_I01942
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family ZF-HD
Protein Properties Length: 81aa    MW: 8741.98 Da    PI: 9.1299
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01942.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.42e-292277359
       ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                      ++rY eC kN+A s+GghavDGC+Efm+  geegtaaal CaACgCHR+FH+r v +
  Eucgr.I01942.1.p 22 TIRYGECEKNQAESIGGHAVDGCREFMAR-GEEGTAAALICAACGCHRSFHKRIVMT 77
                      79**************************8.999*******************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-192278IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.1E-272373IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-232473IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.9232574IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MKRVRVVVVK GSSASSRRRG ETIRYGECEK NQAESIGGHA VDGCREFMAR GEEGTAAALI  60
CAACGCHRSF HKRIVMTENQ *
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01942.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489393.11e-27PREDICTED: mini zinc finger protein 2-like
RefseqXP_012568098.11e-27PREDICTED: mini zinc finger protein 2-like
SwissprotQ9LJW55e-27MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A059AQD81e-51A0A059AQD8_EUCGR; Uncharacterized protein
STRINGSb08g001830.15e-26(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.18e-28mini zinc finger 2